خانه | بالا

تكامل چیست؟

فرخ بیخدا

(دریافت فایل پی دی اف)

مقدمه

نظریه انقلابی

داروین چه گفت

مكانیسم تكامل

ژن

ژنوم

جهش

وراثت

توزیع ژن

انتخاب طبیعی

جدایی تولید مثلی

تكامل كلان

پیچیدگی و اجزاء مرتبط

مفهوم علمی تصادف

شواهد و مدارك

زمین شناسی

جغرافیای زیستی

فسیل شناسی

آناتومی مقایسه ای

جنین شناسی مقایسه ای

زیست شناسی مولكولی

پیشبینی ها

تكامل در پیش رو

نگاهی به آینده

منابع آنلاین برای مطالعه بیشتر

 

مقدمه

 تكامل یا فرگشت (evolution) یک نظریه ی علمی در مورد منشاء گونه ها و تحولات عالم جانداران است. نظریه ی تكامل در تعارض آشكار با باورهای دینی است.(ن.ك تعارض های تكامل و دین) به همین دلیل مورد انتقاد، تحریف و كج فهمی بسیاری از مؤمنان قرار گرفته است و آنان سعی كرده اند با انتقادهای بی اساس این نظریه را باطل جلوه دهند.(ن.ک. هفت انتقاد بی اساس به نظریه تكامل) در این نوشتار سعی شده این نظریه به ساده ترین شكل ممكن، توضیح داده شود. 

شاید ریشه ی برخی از كج فهمی های فارسی زبان ها از این نظریه، ترجمه ی غلط انداز واژه evolution به "تكامل" یا "فرگشت" است. این لغت به معنی "بر آمدن" و اشاره به بوجود آمدن چیزی از چیز دیگر دارد، مثل بوجود آمدن بخار از آب. برخلاف تصور عموم، نظریه ی "برآمدن" به معنای اخلاقی و حاکی از "کمال یافتن" جانداران نیست. این واژه هیچ بار اخلاقی ندارد بلكه تنها تغییر جاندارن را برای انطباق بیشتر با محیط نشان میدهد. متاسفانه واژه ی تكامل به عنوان یك غلط رایج جا افتاده است. پس در این نوشتار هم به ناچار از این واژه ی اشتباه برانگیز اما رایج استفاده میشود.  

بالای صفحه

 

چرا نظریه تكامل انقلابی در علم پدید آورد؟

 ارسطو (384- 322 ق.م)  طبیعت را معجونی از امیال و غایات میدانست، مثلاً تبخیر آب را به این علت میدانست كه آب برای رسیدن به كمال به سمت بالا حركت میكند یا می گفت سنگ به این علت به پایین می افتد که می خواهد به جایگاه طبیعی برسد خود که پایین است ؛ یا تیر به این علت مدتی پس از پرتاب به زمین می افتد که میل طبیعی اجسام به سکون است. تبیین های ارسطویی  نمونه ی نگاه غایت انگار به جهان است.  غایت انگاری یک نگاه پیشاعلمی به جهان است. غایت انگار همه ی اجزای طبیعت را مانند انسان ها دارای امیال و مقاصد می داند. درست مانند کودکی که فکر می کند اسباب بازی هایش هم مانند خودش گرسنه و ناراحت می شوند. غایت انگاری دو هزار سال پس از ارسطو هم بر طرز تفكر جامعه بشری سایه افكند و فرهنگ ها و ادیان جهان را تحت تاثیر قرار داد. این جهان بینی انسان را مركز و محور جهان میدانست[1]. نمونه های فراوانی از این نگرش را در كتابهای مقدس و ادبیات ملل میتوان یافت:

 سوره بقره آیه 189: درباره هلالهای ماه می پرسند ، بگو : برای آن است که مردم وقت کارهای خویش و زمان حج را بشناسند.

سوره انعام آیه 97: اوست خدایی که ستارگان را پدید آورد تا به آنها در تاریکیهای خشکی و، ودریا ، راه خویش را بیابید. 

حق تعالی كاین سماوات آفرید                         از برای رفع حاجات آفرید

(مولوی) 

ابر و باد و مه و خورشید و فلك در كار اند         تا تو نانی به كف آری و به غفلت نخوری (سعدی)

 

واین زمین مضطرب محتاج كوه[2]                    گر نبودی نافریدی پر شكوه

(مولوی)

 نیوتون با نشان دادن قانون مندی حركتهای فیزیكی نشان داد كه همه ی كار جهان برای منفعت انسان نیست. قانون های نیوتون نشان میداد كه حركت های ابر و باد و مه و خورشید تنها و تنها به علت تاثیر نیروهای طبیعی بر آنهاست.  این حركت علمی سرآغاز تحول فكری اروپا شد. اندیشه ی علمی و روش تجربی، بنیان معارف باستانی را برافکنند و پیشرفت های روز افزون مغرب زمین آغاز شد[3].  

نیوتون مکانیک ارسطویی را باطل کرد، اما ابطال کامل زیست شناسی ارسطویی کار شگرف داروین بود. ارسطو فکر می کرد که گونه های جانداران از ابتدای جهان به صورت کنونی از هم جدا بوده اند، چون هیچ کس ندیده که میمونی انسان بزاید. میمون همیشه میمون می زاید!  در میانه ی قرن نوزدهم دنیای فیزیك و شیمی دنیای قانونها بود اما قوانین حاکم بر جهان جانداران هنوز در پرده ای از ابهام بودند. داروین نشان داد كه چگونه موجودات زنده طی یک فرایند کاملاً طبیعی تکامل یافته اند. به گفته ی خود او: " ایجاد گرامی ترین چیزهایی که می شناسیم، یعنی ایجاد جانداران عالی، مستقیماً محصول ستیزه ی طبیعت، قحطی و مرگ است."[4] امروزه دانش زیست شناسی با صراحت اعلام میكند كه حیات در عین پیچیدگی، جلوه ای از واكنشهای شیمیایی و فیزیكی است. 

آن مدعیان كه دُر معنی سُفتند و از چرخ به گونه گون سخنها گفتند

آگه چو نبودند ز اسرار نهان              با خود زَنَخی زدند و آخر خفتند

خیام[5] 

تكامل زیست شناسی را از علمی مشاهده ای و توصیفی به علمی فعال و تجربی تبدیل كرد. زیست شناسِ پیش از داروین جانداران را تنها مشاهده یا حداكثر تشریح میكرد. او تنها نظاره گر بود؛ نه می توانست تحلیل کند، و نه به چراها و چگونه ها[6] پاسخ گوید. داروین راهی را نشان داد كه در آن باید به هر جانور، اندام تا مولكول زیستی به شكل یك سوال نگریست. باید همه اطلاعات را تحلیل كرد و به جواب رسید. شیوه تفكر داروینی تاثیر عمیقی بر ادراك دانشمندان همه ی علوم تجربی و انسانی بر جای گذاشت.

 بالای صفحه

داروین چه گفت؟

 چارلز داروین (1809-1882) زیست شناس بریتانیایی، پس از سی سال مطالعه و بررسی شواهد سفر تحقیقاتی پنج ساله اش به دور دنیا، در سال 1859 نظریه ی تكامل را در تاثیر گذارترین كتاب تمام دورانها، یعنی "منشاء انواع بوسیله به انتخاب طبیعی"[7] به جهان علم عرضه كرد[8].

 

شکل 1

نظریه تكامل داروین را میتوان به صورت زیر خلاصه كرد:

1- تعداد زادگان (نوزادان) بیشتر از والدین است.

2- تعداد افراد در جمعیت تقریباً عددی ثابت است.

3- زادگان تفاوتهایی جزئی با والدین خود دارند.

4- تنها زادگانی زنده می مانند كه سازش بیشتری با محیط داشته باشند. 

در طبیعت، افرادی كه مزیتی هرچند اندك، بر دیگران داشته باشند شانس بیشتری برای زنده ماندن و تولید مثل دارند. در دراز مدت نسل این افراد، جمعیت غالب گونه را تشكیل خواهد داد. داروین این فرایند را انتخاب طبیعی نامید.  

با پیشرفت فزاینده ی علوم مختلف، نظریه ی تكامل نیز منسجم تر شد و حیطه های جدیدی مانند علم ژنتیك و زیست شناسی مولكولی را در بر گرفت. امروزه از نظریه ی پیشرفته تر تكامل تحت عنوان "تلفیق نوین" یا "سنتز جدید" استفاده میشود.  

 بالای صفحه

مكانیسم تكامل

 

ژن 

یك CD صوتی حاوی اطلاعات لازم برای پخش موسیقی است اما سر و صدا نمیكند! برای شنیدن موسیقی باید اطلاعات CD را در دستگاهی اجرا كرد. ژن ها هم حاوی اطلاعات هستند و برای انجام كار باید این اطلاعات اجرا بشود. به بیان علمی باید ژن بیان بشود. بیان شدن ژن بدین صورت است كه از روی اطلاعات موجود بر روی ژن، پروتئین ساخته میشود و پروتئین ها هر کدام كاری را در بدن انجام میدهند. 

ژن قسمتی از مولكولی خطی به نام DNA است كه اطلاعات لازم برای ساخت یك پروتئین را در خود دارد. این اطلاعات در DNA به وسیله توالی مشخصی از چهار كد مختلف حفظ میشود. DNA از چهار زیر واحد آدنین(A) ، تیمین (T) ، سیتوزین(C) و گوانین (G) تشكیل شده است.

 

شکل 2

 

 بالای صفحه

 

ژنوم

به مجموعه ی كل DNA های موجود در سلول ژنوم گفته میشود. ژنوم اطلاعات لازم برای تمام اعمال سلول را در خود دارد. ژنوم باكتری ها به صورت یك DNA خطی و حلقوی است اما ژنوم دیگر جانداران بصورت چندین قطعه جداگانه است كه كروموزوم نامیده میشوند.

 

شکل 3

بالای صفحه

جهش

گفتیم كه DNA دارای توالی مشخصی از چهار كد است. هر گونه تغییر در این كدها جهش نام دارد. عوامل گوناگونی میتوانند جهش ها را بوجود آورند. برخی مواد شیمیایی (كه در درون سلول ها هم وجود دارد) جهش زا هستند. عوامل فیزیكی مانند حرارت و پرتوهای ماوراءبنفش و پرتوهای رادیواكتیو نیز جهش زا هستند. جهش در فرایند تولید مثل نیز رخ میدهد. در تولید مثل، كد ژنتیكی باید دو برابر شود ولی در این فرایند اشتباه هایی هم رخ میدهد و موجب میشود كه كپی دقیقاً برابر با اصل نباشد.  

جهش ها انواع گوناگونی دارند. تغییر در یك حرف از كد ژنتیكی جهش نقطه ای نامیده میشود. جهش های وسیعتر مجموعه ای از كدها را دستخوش تغییر میكنند. تغییر در كروموزوم ها به طور همزمان چند هزار ژن را تغییر میدهد. یكی از مهمترین انواع این جهش ها مضاعف شدن است. در مضاعف شدن دو نسخه از یك ژن بوجود می آید. هر یك از این ژنها میتوانند جداگانه دستخوش جهش های جدید شوند و بدین ترتیب با حفظ ژن قبلی، ژن جدیدی به ژنوم جاندار اضافه شود كه اندكی با ژن قبلی فرق دارد. 

بیش از نود درصد از جهشها مضر هستند. اما باقی جهش ها كم اثر، بی اثر یا مفیدند. جهش های مضر اغلب موجب مرگ جاندار میشود و به نسل بعد انتقال پیدا نمیكند اما جهش های كم اثر، بی اثر و مفید به نسل بعد منتقل میشوند.

 

شکل 4

 بالای صفحه

شکل 5

دو سیستم وراثت ژن

باكتریها و برخی تك سلولی ها تولید مثل غیر جنسی دارند. در این شیوه ژنوم فرزندان با والدین كاملاً شبیه هم است و تكامل فقط به جهش ها بستگی دارد. اما در تولید مثل جنسی، فرزند نیمی از ژنهایش را از پدر و نیم دیگر را از مادر دریافت میكند. این سیتم دو مزیت تكاملی دارد: الف) ایجاد تنوع در جاندار تنها وابسته به جهش نیست. ب)ژنها در میان جمعیت توزیع میشوند.

 

تصویر 6

بالای صفحه 

توزیع ژن

فرض كنید در شهری همه مردم ژن A را دارند. در اثر جهش در یك نفر از آنها ژن A به B تبدیل میشود. این فرد پس از ازدواج ژن B را به فرزندانش منتقل میكند. پس از گذشت چند قرن با ازدواج و زاد و ولد های مكرر ژن B در سطح شهر پراكنده شده است به طوری كه مثلاً 90%  درصد از مردم ژن A و 10% باقیمانده ژن B را دارند. به همین ترتیب هر ژن جدیدی در میان جمعیت پراكنده می شود.

 

تصویر 7

 بالای صفحه

انتخاب طبیعی

به دلیل محدود بودن جمعیت هر جاندار همه ی نوزادان توانایی زنده ماندن را ندارند. در مثال بالا فرض كنید ژن A عامل لاغری بوده و ژن B چاقی را بوجود می آورد. با فرا رسیدن عصر یخبندان، چاق ها دارای مزیت ذخیره سازی غذا هستند و لاغرها بیشتر میمیرند. بنابراین صاحبان ژن B بیشتر زنده میمانند. پس توزیع ژن در جمعیت دگرگون میشود به شكلی كه 90% ژن B را دارند. با پایان یخبندان، چاقی نه تنها مفید نیست بلكه دردسر ساز است. همین امر دوباره توزیع ژن  A را به 90% میرساند. به این ترتیب توزیع ژن ها با تغییر محیط دچار تغییر می شود. تغییر محیط گاه آنچنان وسیع است كه یكی از ژن ها را به طور كامل منقرض میكند. توجه داشته باشید كه هر جاندار دارای هزاران ژن است و توزیع همه این ژن ها مرتباً در حال تغییر است. بنابراین خصوصیات جمعیت های جانداران دائماً در حال تغییر است، به صورتی كه پس از گذشت چند صد هزار یا چند میلیون سال ممكن است به جاندار جدیدی تبدیل شده باشد.

 بالای صفحه

جدایی تولید مثلی

گفتیم كه هر جمعیت در طول زمان دچار تغییر میشود و این تغییرات در تمام جمعیت توزیع میشود. پس چگونه است كه گونه های جدید بوجود می آیند؟ همانطور كه همه اندامهای جاندار تغییر میكنند تغییراتی هم در خصوصیات تولید مثلی بوجود می آید. به گونه ای كه ممكن است جمعیت به دو گروه تقسیم شود كه دیگر توانایی تولید مثل با یكدیگر را نداشته باشند. جدایی تولید مثلی علتهای مختلفی دارد: 

جغرافیایی: پیشروی بیابان میتواند یك جنگل را به دو قسمت تقسیم كند و جانداران این دوقسمت دیگر ارتباطی با هم نخواهند داشت. همچنین مهاجرت عده ای از افراد به سرزمینی دور آنها را بقیه جمعیت جدا میكند.

فیزیولوژیك: تغییر در اندام تناسلی باعث میشود كه یك گروه از جمعیت توانایی تولید مثل با بقیه را نداشته باشند.

تغییر در زمان یا فصل تولید مثل: ممكن است فصل جفت گیری در برخی افراد با بقیه متفاوت شود. مثلاً همه مگس های میوه را میتوان در آزمایشگاه مجبور به تولید مثل كرد ولی در طبیعت دو گروه از این مگس وجود دارد. گروهی صبح جفت گیری میكند و گروه دوم بعد از ظهر.

تغییر در عادات جفت گیری: این تغییر موجب میشود كه گروهی از افراد، جفت خود را تنها از میان دیگر اعضاء گروه خودش انتخاب كنند.

تغییرات سلولی: جفت گیری بین دو گروه انجام میشود ولی لقاح ناقص است یا نوزاد میمیرد. حتی ممكن است نوزاد زنده بماند ولی عقیم باشد (مثل قاطر).  

جدایی تولید مثلی به هر علتی كه روی دهد موجب میشود تا توزیع ژنی هر گروه از جمعیت به طور جداگانه تغییر كند و جهش های بوجود آمده تنها در میان افراد همان گروه باقی بماند. به عبارت دیگر دو جمعیت وجود خواهد داشت كه هر كدام به راه خودش میرود. پس از گذشت هزاران سال میزان تغییرات در هر گروه آنقدر زیاد می شود كه دیگر تبدیل به دو گونه جاندار متمایز تبدیل می شوند. به این ترتیب دو گونه جدید از گونه اولیه بوجود می آید.

تصویر 8

بالای صفحه

تكامل كلان[9]

 تا این بخش از نوشتار در مورد تكامل یك گونه در ارتباط با محیط آن (تكامل خٌرد[10]) توضیح مختصری داده شد. هر جانداری برهمكنش های گسترده ای با دیگر جانداران دارد. پرنده ای حشره خوار، خودش توسط چندین صیاد شكار میشود؛ و دیگر حشره خوارها بر سر غذا با او رقابت می كنند. رقابت بر سر محل آشیانه هم در جریان است. به طور كلی تغییر یك گونه دیگر گونه ها را متاثر می كند. چابكتر شدن شكار، شكارچی را نیز تغییر می دهد. به این ترتیب باید تكامل گونه های جانداران را با هم (تكامل كلان) بررسی كرد نه جدا از هم.

 

پیچیدگی و اجزاء مرتبط

منتقدین نظریه تكامل علاقه ی زیادی به "پیچیدگی" دارند. مثلاً می گویند اندام X پیچیده تر از آن است كه بوسیله تكامل بوجود بیاید. یا اظهار نظر می کنند كه اجزای اندامی مانند چشم در ارتباط با هم هستند و وجود هر یك از اجزا برای كاركرد چشم ضروری است: یک چشم نصفه نیمه به هیچ دردی نمی خورد. پس اندام های پیچیده  نمیتوانند حاصل تكامل تدریجی باشند. این انتقادها جدای از بهانه گیری، ناشی از عدم درك تكامل هستند[11].  

پیشرفت اختراع های بشر تقریباً شبیه به تكامل جانداران است. اتوموبیل های اولیه تنها گاری هایی بودند كه موتور داشتند. با گذشت زمان قطعات بیشتری به این وسیله اضافه شد تا به شكل امروزی آن درآمد. قطعه ای مانند انژكتور در ماشین اولیه وجود نداشت ولی در اتوموبیل امروزی اگر انژكتور از كار افتاد، كل ماشین دیگر قادر به حركت نیست.  

تكامل اندامهای پیچیده نیز از یك شكل ساده اولیه شروع شده و در طول زمان اجزاء دیگری به اندام اضافه شده است به شكلی كه آن جزء، تبدیل به بخشی ضروری در كاركرد اندام شده است. در هر حال، داشتن یک چشم نصف و نیمه هم خیلی بهتر از چشم نداشتن است. چشم در بی مُهرگان اولیه تنها شامل چند سلول برای تشخیص تاریكی از روشنایی بوده است. بعد ها سلول های تشخیص دهنده رنگ و اجزائی مانند عدسی به این سیستم اضافه شده است. تكامل چشم و دیگر اندامهای پیچیده به طور كامل توضیح داده شده است.  

با پیشرفت زیست شناسی، منتقدان توجه خود را به سیستم های پیچیده سلولی مانند سیستم ایمنی و ساختارهای پیچیده مولكولی مانند موتور تاژك باكتری ها معطوف كردند. با اینکه شیوه ی تكامل پیچیده ترین سیستم های زیستی شناخته شده یا در دست تحقیق است، اما بهانه گیران دست بردار نیستند و با هر كشف تازه در زیست شناسی باید منتظر چنین خرده گیری هایی باشیم. (برای اطلاع بیشتر به بخش پرستش شكافها از كتاب پندار خدا نوشته ریچارد داوكینز مراجعه كنید)

 بالای صفحه

مفهوم علمی "تصادف"

برخی دینداران منتقد نظریه ی تکامل می گویند: امکان ندارد که نظم و پیچیدگی جهان جانداران "تصادفی" به وجود آمده باشد. و ادامه می دهند که حتی اگر نظریه ی تکامل نیز درست باشد، حتماً باید خالقی در کار بوده باشد که با طرح و تدبیر خود سیر تکاملی را هدایت کرده و به اینجا رسانده است. این ایراد می تواند نشانگر بدفهمی عمیق نظریه ی تکامل باشد. تکامل تصادفی نیست. آنچه می توان گفت "تصادفی" است، جهش های ژنتیکی هستند. و جهش های ژنتیکی فقط به این معنا "تصادفی" هستند که وقوع شان محصول طرح و تدبیر کسی نیست. جهش ژنتیکی همان قدر"تصادفی" است که باران، آتش فشان، گردش سیارات یا هر پدیده ی طبیعی دیگر"تصادفی" است. موتور پیش برنده ی تکامل (که همان گزینش فزاینده از میان جهش های ژنتیکی باشد) نیازمند طراحی نیست. و همین نکته است که زیرآب یکی از قدیمی ترین و مهم ترین برهان های خداباوری، یعنی برهان نظم را می زند. 

پس در مورد كلمه ی "تصادف" در علم باید به نكات زیر توجه كرد: 

1- بعید بودن تصادف به معنی غیر ممكن بودن آن نیست. از احتمالات نمیتوان برای رد رویداد های پسگشتی (Backward) استفاده كرد. اگر فکر می کنید جز این است، این بازی را انجام دهید: تعداد کافی کارت تهیه کنید، آنها را از یک تا یک میلیارد شماره گذاری کنید (در صورتی که مایل باشید بیشتر) و بعد از بین این یک میلیارد کارت یکی را بیرون بکشید. تعجب نکردید؟! عددی بیرون آمد که احتمال بیرون آمدنش یک در میلیارد بود! چطور چنین چیزی ممكن است؟! چطور چنین اتفاق بعیدی رخ داد؟ بازی را تکرار کنید، و هر بار بدون استثنا چنین اتفاق عجیبی می افتد! 

2- نباید تنها به عامل تصادفی تكامل (جهش) توجه كرد و عامل غیر تصادفی یعنی گزینش یا انتخاب طبیعی را از نظر دور داشت. ریاضی دان آماتوری كه به اخبار گوش میداد شنید: اجتماع صد نفره زنان بسیجی در تالار وحدت برگزار شد. او با خودش حساب كرد كه احتمال اینكه هر انسانی زن باشد یك دوم است. پس احتمال اینكه همه ی آن صد نفر زن باشند 2/1 به توان 100 است. یعنی 1 در 1267650600228229401496703205376 است. ثانیاً احتمال بسیجی بودن یا نبودن یك زن یك دوم است درنتیجه این عدد را باید در خودش ضرب كرد. پس جمع شدن تصادفی صد زن بسیجی در یكجا غیر ممكن است. ریاضی دان ما وجه گذینشی ماجرا یعنی "تنها زنان بسیجی دعوت می شوند" را فراموش كرده بود. منتقدان "تصادف"، اغلب "بقای اصلح در اثر انتخاب طبیعی" فراموش می کنند. 

3- نباید مفهوم "فزایندگی" را در مورد تصادف از نظر دور داشت. فزایندگی بدین ترتیب است كه پس از یك رویداد تصادفی، تصادف بعدی در میان اعضاء انتخاب شده از تصادف اول انجام میشود. به عبارت دیگر در هر مرحله، محصولات تصادفی مرحله قبل که از صافی انتخاب طبیعی گذشته اند دچار تصادف جدیدی می شوند. نظم موجود در سیستم های طبیعی ناشی از این نوع تصادف است.[12] اجزاء مختلف بر اثر این "تصادف" ها در کنار هم قرار میگیرند و حد واسطهای ناپایدار از میان میروند و تنها اجزائی که به صورت پایداری با دیگر اجزاء در ارتباط هستند باقی میمانند. این فرآیند را گزینش فزاینده مینامند[13].(ن.ك برهان نظم و مسئله گزینش فزاینده) بازی شیر یا خط زیر را در نظر بگیرید: چند هزار میلیارد سكه را روی زمین بریزید. آنهایی كه شیر آمده اند را بردارید و بقیه را كنار بگذارید. سكه هایی را كه برداشته اید دوباره روی زمین بریزید و فقط شیر ها را بردارید. اگر این كار را چند میلیون بار تكرار كنید، سرانجام یك (یا چند تایی) سكه باقی خواهد ماند كه تصادفاً ملیونها بار، پشت سر هم شیر آمده است.[14] حال به جای "سکه ها"، جانداران را بگذارید، به جای "شیر آمدن" انطباق بهتر با محیط، و به جای "کنار گذاشتن بقیه"، انتخاب طبیعی را بگذارید.  آیا "تصادف" تکامل هنوز باور نکردنی می آید؟

بالای صفحه 

چه شواهدی بر صحت نظریه تكامل وجود دارد؟

هر نظریه ی علمی به وسیله شواهدی پشتیبانی میشود. تكامل نیز بوسیله شواهد تجربی محکم و همبسته ای در زیست شناسی و دیگر علوم حمایت میشود. هر كدام از این شواهد نه تنها مانند قطعه ای از یك پازل بقیه شواهد را تكمیل می كند، و نتایج مستقل هر شاهد با نتایج مستقل منبع دیگر یكسان است. مثلاً یك فسیل شناس درختچه تكاملی انسان را رسم می كند و یك متخصص ژنتیك نیز این درختچه را بر اساس ژنتیك رسم می كند. مشاهده میشود كه درخت رسم شده در هر دو علم مشابه هم است. در اینجا تنها به شواهد معروف تکامل اشاره ی مختصری می کنیم و از بحث های پیچیده زیستی، شیمیایی و فیزیكی صرف نظر می کنیم[15]. 

ممكن است در اینجا عده ای اعتراض كنند که چرا شواهدی را  كه در رد نظریه تكامل وجود دارد را نمی گویید و یك طرفه به قاضی میروید؟ در پاسخ باید گفت: حتی یک شاهد علمی خلاف نظریه ی تکامل وجود ندارد. به عبارت دیگر اگر مدركی بر خلاف تكامل وجود داشت دانشمندان اول از همه این نظریه را کنار می گذاشتند، یا تصحیح می کردند. البته انتقادها و ایرادهایی به تکامل می گیرند ولی این "انتقادات" بویی از علم نبرده اند و همگی از منبر و بازار بر می آیند تا از دانشگاه و آزمایشگاه. (ن.ک. هفت انتقاد بی اساس به نظریه تكامل)

 بالای صفحه

 

زمین شناسی

پژوهش های زمین شناسی بیانگر عمر طولانی سیاره زمین است. زمین در طول عمر خود دورانهای متعددی را پشت سر گذاشته است. تكامل جانداران نیز نیاز به زمان طولانی دارد[16]. در نظریه تكامل گفته شده كه جانداران با تغییر محیط تغییر میكنند. بنابر این با تغییرات زمین باید تغییر در جانداران نیز دیده شود. به بیان دیگر باید تحولات زمین و فسیل ها هم زمان، مرتبط و معنی دار باشند. چنین پیوستگی در تمامی فسیل ها مشاهده میشود. به عنوان مثال فسیل های جانوران پشمالو مربوط به دورانهایی است كه زمین شناسان آنها را عصر یخبندان مینامند. در مورد منشاء حیات نیز بیومولكول ها و سلول ها تنها در شرایط خاص میتوانند از ماده بیجان بوجود آیند و علم زمین شناسی با تعیین ویژگیهای زمین اولیه این حقیقت را آشكار میكند كه شرایط برای ایجاد مولکول اسیدهای آمینه، (مولکول های سنگ بنای حیات) مهیا بوده است. در واقع دانشمندان با شبیه سازی شرایط اولیه ی زمین در آزمایشگاه، شاهد ایجاد برخی از این اسیدهای آمینه بوده اند.

 بالای صفحه

جغرافیای زیستی

هر گونه از جانداران در ناحیه ی جغرافیایی خاصی قرار دارد. جانداران هر منطقه ی جغرافیایی شباهت بیشتری با همخانواده های ناحیه ی خود دارند، تا با جانداران دوردست. معروفترین این شباهت ها را در پستانداران استرالیا میتوان یافت. بسیاری از پستانداران استرالیا مانند کانگور و کوآلا كیسه دار و مختص خود استرالیا و جزایر اقیانوسیه هستند. چنین شباهتهایی در مورد محل زندگی همه جانداران صادق است به طوری كه گستره ی جغرافیایی هر گونه با تاریخچه تكاملی آن ارتباط دارد. یكی از مواردی كه داروین را به سمت نظریه تكامل هدایت كرد این بود جانوران جزایر دور افتاده مانند خود آن جزایر از بقیه دنیا دور افتاده اند.

تصویر 9

 بالای صفحه

فسیل شناسی

در فسیل ها میتوان حوادث چند ملیون ساله تكاملی را مشاهده كرد. فسیل ها در چینه های زمین شناسی ماندن کلمات در کتاب تاریخ طبیعی هستند. هر گاه فسیلی یافت میشود، ابتدا عمر آن بوسیله نیمه عمر عناصر رادیو اكتیو تعیین میشود. سپس متخصصان فسیل شناسی اجزاء آنرا جزء به جزء بررسی میكنند تا ببینند مربوط به چه جانوری است. بسیاری از فسیل ها حد واسط تكاملی میان دو جاندار هستند. برخی فسیل ها، شاهدی بر تكامل بین دو گروه از جانداران مانند دایناسورها و پرندگان هستند. هر چه تعداد فسیل های یافت شده میان دو جاندار بیشتر باشد، تصویر روشنتری از تاریخ طبیعی بدست می آید. 

با توجه به سخت بودن شرایط تشكیل فسیل ها، كاملاً طبیعی است كه بین دو فسیل حد واسط شكافهایی یافت شود كه "حلقه های مفقوده" نامیده میشوند. در زمان داروین تعداد حلقه های مفقوده بسیار زیاد بود، اما از آن تاریخ رده كاملی از فسیل ها بین دایناسورها و پرندگان، چهارپایان و پستانداران دریایی و میمون ها و انسان وجود دارد. باید توجه داشت كه ممكن است فسیل حلقه ای مفقوده در جایی قرار داشته باشد كه هیچگاه آنرا پیدا نكنیم و یا حتی هیچ فسیلی از جاندار مورد نظر تشكیل نشده باشد. با این وجود تاریخچه تكاملی جانداران را میتوان با استفاده از روشهای كارامدی چون آناتومی مقایسه ای و شواهد مولكولی معین كرد. علاوه بر این، نباید از كارآگاهان جنایی انتظار داشت كه از لحظه به لحظه ی وقوع جنایت فیلم برداری كرده باشد. (اگر قاضی چنین مدركی از كاراگاه بخواهد شما در مورد عقل قاضی چه قضاوتی می كنید؟)

تصویر 10

بالای صفحه

آناتومی مقایسه ای

 شباهت و تفاوت های اندامها و دستگاههای جاندارن كاملاً معنادار و در راستای سیر تكاملی آنها است. تمام مهره داران چارچوب اسكلتی یكسانی دارند و تفاوتها متناسب با فاصله ی تكاملی دو گونه است. اندامهای ظاهراً متفاوت مثل بال پرندگان و دست پستانداران اسكلت یكسانی دارند. وجود اندامهای همساخت[17] تنها با نظریه تكامل توجیه پذیر است[18]. نكته ی دیگر اینكه تفاوت و شباهت همه ساختارهای دو گونه كاملاً همسان است. مثلاً ارتباط تكاملی دستگاه گوارش انسان و گوزن با ارتباط دستگاه عصبی و همه دستگاهها و اندام های این دو گونه یكسان است. 

ساختارهای ناقص[19]: از آنجا كه انتخاب طبیعی تنها بر جمعیت های موجود اثر میكند مشاهده اینكه ساختاری به درستی با نیازهای جاندار سازگار نباشد، عجیب نیست. تعداد مهره های گردن مهره داران زیاد و مثلاً در غازها 25 عدد است ولی گردن پستانداران تنها 7 مهره دارد. گردن دراز زرافه نیز تنها 7 مهره دارد، درنتیجه گردنِ به این درازی هیچگونه انعطاف پذیری ندارد. نمونه دیگری از این طرح های ناقص[20]  چشم مهره داران مانند انسان است. شبكه عصبی موجود در چشم به گونه ای است كه یك نقطه كور در گستره بینایی بوجود می آورد (با اینكه ساختار چشم تصویر كاملی را بر روی شبكیه ایجاد میكند تنها بخشی از این تصویر به مغز میرسد) درحالی كه چشم بی مهرگان گستره بینایی كاملی دارد.  

ساختارهای باقیمانده[21]: اندام هایی هستند كه هیچ فایده ای برای جاندار ندارند و تنها باقی مانده اندامهای اجداد آن جاندار هستند. این اندامها كاربردی ندارند ولی سلول های آنها بیهوده انرژی و مواد غذایی مصرف میكند. به وزن جاندار می افزایند كه سبب نیاز به انرژی حركتی بیشتر میشود. این اندام ها حجمی را در بدن جاندار اشغال میكنند و عملكرد دیگر اندامها را كاهش میدهند و در نهایت ممكن است دچار جراحت یا عفونت شوند. چند نمونه: چشمهای نابینا در ماهیهای كور غار، باقیمانده استخوان پا در نهنگ و مار بوا در حالی كه پا ندارند، ناخن در باله گاو دریایی، انگشت در بال بعضی پرندگان، آپاندیس، مهره های دُم و بیش از صد عضو بی فایده دیگر در انسان.

 

تصویر 11

 بالای صفحه

جنین شناسی مقایسه ای

شباهت جنین جانداران آنچنان زیاد است كه تشخیص جنین پرنده از پستاندار در نگاه اول میسر نیست. جنین هر گروه از جانداران و مراحل رشد و نمو آن مشابه است. مثلاً شكل و مراحل نمو جنین تمامی پستاندارن مانند هم است و میزان تفاوتهای جزئی با رابطه تكاملی مطابقت دارد. مطالعه جنین ها از تخم ماهیها تا پستاندارن بخش مهمی از پژوهش های تكاملی را شامل می شود.  

 

زیست شناسی مولكولی

"هدف زیست شناسی نوین، درك و توجیه خصوصیات موجودات زنده بر حسب ساختار مولكول های تشكیل دهنده آن است."(فرانسوا ژاكوب، 1972) در قرن بیستم علم زیست شناسی وارد دنیای مولكولها شد و علوم مولكولی مانند بیوشیمی و ژنتیك تمام زمینه های این علم را تحت تاثیر قرار دادند. تكامل نه تنها در سطح مولكولها قابل مشاهده است بلكه ویژگیهای بیومولكولها را تنها با تكامل میتوان توجیه كرد. 

مقایسه مولكولها یكی از بهترین روشها مطالعه تكامل است. با پایان یافتن پروژه ژنوم انسان و مقایسه آن با پروژه ژنوم شامپازه مشاهده شد كه این دو ژنوم تنها 1.6% اختلاف دارند. با پیشرفت روش های استخراج ژن دانشمندان توانستند در یك پروژه حیرت انگیز ژنهای یك فسیل 32 هزار ساله انسان نئاندرتال[22](گونه ای منقرض شده از جنس انسان) را استخراج كرده و رابطه مولكولی این فسیل را با انسانهای ساپینس[23](گونه خود ما و تنها گونه باقی مانده از جنس انسان) را مشخص نمایند[24].

 

كد 153 حرفی میوگلوبین انسان و شامپانزه تنها در یك حرف اختلاف دارد

 

GLSDGEWQLVLNVWGKVEDAIPGHGQEVLIRLFKGHPETLEK

FDKFHLKSEDEMKASEDLKKGGILKKKHGATVLTALKKKGHH

EAEIKPLAQSHATKHKIPVKYLEFISECIIQVHSKHPGDFGADA

QGAMNKALELFRKDMASNYKELGFQG

 

 انسان ساپینس

 

GLSDGEWQLVLNVWGKVEDAIPGHGQEVLIRLFKGHPETLEK

FDKFHLKSEDEMKASEDLKKGGILKKKHGATVLTALKKKGHH

EAEIKPLAQSHATKHKIPVKYLEFISECIIQVQSKHPGDFGADA

QGAMNKALELFRKDMASNYKELGFQG

 

 شامپانزه

 بالای صفحه

در سالهای پایانی قرن بیستم با همه گیر شدن استفاده از كامپیوتر و اینترنت، امكان تحلیل حجم بالایی از اطلاع مولكولی فراهم شد. امروزه هر دانشجوی زیست شناسی میتواند با مراجعه به بانك های اطلاعاتی آنلاین به صورت رایگان، مولكول مورد نظرش را با همه مولكولهایی كه تاكنون كشف شده اند مقایسه كند، سپس این اطلاعات را به كمك نرم افزارهای پیشرفته تحلیل كند. به همین دلیل زیست شناسی مولكولی به سریعترین، دقیقترین روش در پژوهش های تكاملی تبدیل شده است. 

وارسی مولكولی تكامل تنها به مقایسه كدهای مولكولها محدود نمی شود بلكه در سطحی بالاتر به ساختار سه بعدی و بخش عمل كننده ی مولكولها[25] ، خواص بیوفیزیكی آنها و سیستم های شبیه سازی تكامل مولكولی توجه میشود. 

مسائلی كه در بخش آناتومی مقایسه ای ذكر شد در بخش مولكولی هم وجود دارد: همسانی، همساختی، همسویی، ساختارهای ناقص و ساختارهای باقیمانده و بی فایده.

 

تصویر 12

بالای صفحه

پیشبینی ها

 نظریه های علمی دارای خصوصیات "توانایی پیشگویی" و "ابطال پذیری" هستند.(ن.ك علم و ماوراء الطبیعه بخش خصوصیات علم) نظریه ی تکامل  این پیشگویی قوی را دارد که حتی اگر یک فسیل در چینه ی زمین شناختی نادرست یافت شود، کل نظریه بر باد فنا می رود. به رغم افسانه های کذب از آب درآمده ی خلقت گرایان، که مثلاً گفته اند جمجمه ی انسان در غار مِژر، یا رد پای انسان در میان فسیل های دایناسورها کشف شده، تاکنون حقیقتاً هیچ فسیل نابهنگام اینچنینی یافت نشده است. 

ویژگی های جد مشترك دو گونه ی خویشاوند را میتوان بدون وجود هر گونه شاهد فسیلی، تعیین كرد. تا پیش از دهه 90 جانورشناسان میدانستند كه گرگ سانان و سگ سانان پسر عموهای تكاملی هم هستند و خصوصیات جد مشترك آنها را ذكر كرده بودند ولی فسیلی در این مورد یافت نشده بود. تا اینكه در سال 1996 فسیلی كه ویژگیهای آن قبلاً ثبت شده بود در آلمان یافت شد. صدها مورد از این دست در ژورنالهای تخصصی بیولوژی به ثبت رسیده است. امروزه با مشخص بودن تاریخچه تكاملی جانداران، بیشتر فسیلهایی كه یافت میشوند گمشده های آشنا هستند تا غریبه های نا آشنا. 

تكامل در پیش رو

مكانیسم تكامل را باید در طبیعت یا آزمایشگاه مطالعه كرد. اما سرعت تولید مثل جاندارانی مثل انسان آنقدر كند است كه برای مشاهده تكامل آن باید چند صد هزار یا حتی میلیونها سال صبر كرد. اما بسیاری از جانداران دارای تولید مثل سریع هستند به طوری كه در عرض چند سال میتوان چند صد نسل از آنها را مشاهده كرد. مگس میوه یكی از بهترین نمونه های آزمایشگاهی برای مطالعه تكامل است زیرا هر روز تولید مثل میكند و در هر سال میتوان 365 نسل از آنرا بررسی كرد. سرعت تكثیر باكتریها از این هم بیشتر است به طوری كه میتوان در هر شبانه روز  تا 40 نسل از آنها را مطالعه كرد.  

بالای صفحه

یك نمونه كلاسیك از مشاهده تكامل در طبیعت، تغییر رنگ صنعتی[26] در پروانه های منچستر است. تا قرن نوزدهم، شب پره های منچستر عموماً سفید رنگ بودند و بر سطح درختهای سفید رنگ به خوبی استتار میشدند. در اثر انقلاب صنعتی، و ایجاد کارخانه های دودزای  فراوان در آن منطقه، سطح درختهای منچستر دود زده و سیاه رنگ شد. در سطح درختان تیره و تار، پرندگان به راحتی می توانستند بال های سفید شب پره ها را تشخیص دهند و آنها را شکار کنند. در چنین شرایطی یک شب پره ی سیاه شانس بیشتری داشت تا از چشم شکارچیان گرسنه مخفی بماند  و بتواند تولید مثل کند. در عمل همین امر رخ داد. در اثر جهش تصادفی ژنتیکی، شب پره های سیاه رنگی ایجاد شدند . این شب پره ها به خاطر مزیت استتار بیشتر توانستند، بهتر از اقوام سفید رنگ شان از دید پرندگان شکارچی مخفی بمانند و تولید مثل کنند. در نتیجه، ظرف چند سال شب پره های سیاه در منچستر فراوان تر از شب پره های سفید شدند. اما در قرن بیستم، با پیشرفت فن آوری و کاهش آلودگی هوا، وضعیت هوای منچستر هم بهتر شد. چون هوا دیگر مانند قبل تیره و تار نبود، درختها هم كم كم رنگ طبیعی خود را بازیافتند و مزیت استتار شب پره های سیاه هم از بین رفت. و باز شب پره های سفید در جمعیت غلبه یافتند.

تصویر 13

بالای صفحه 

دانشمندان صدها مورد از تكامل جاندارن را در طبیعت مشاهده كرده اند و هر روزه این فرآیند ها در آزمایشگاه مورد پژوهش قرار می گیرد. 

 

نگاهی به آینده

هدف مطالعه نظریه تكامل، اثبات آن به دینداران نیست، بلكه همانطور كه شیمیدان باید اتم را بشناسد تا مواد شیمیایی را در راه رفاه انسان (و متاسفانه گاهی بر علیه انسانها) به كار گیرد، زیست شناس نیز باید تكامل را درك كند و بكار بندد.  نظریه تكامل، تاریخ زیست شناسی را به دوران پیشرفت و زایندگی رساند. در قرن بیستم، كشف سازوكار پدیده های زیستی باعث شكوفایی پزشكی، كشاورزی، دامداری و صنعت شده است. شناخت پیشینه ی طبیعی انسان نگرش علوم انسانی همچون فلسفه، جامعه شناسی و روانشناسی را تحت تاثیر قرار داده است تا با آگاهی از نیازها، امكانات و محدودیت های حقیقی بشر دیدگاه و راهكارهای خود را اصلاح كنند. 

اولین سالهای قرن بیست و یكم شاهد بزرگترین پژوهش های تكاملی بوده است. با پایان پروژه ژنوم ماهی بادكندكی[27](سال 2002) و نوعی موش[28](سال 2002)، ومقایسه تطبیقی آن با ژنوم انسان(سال 2001) شاهراه فراخی برای شناخت و درمان بیماریهای ژنتیكی انسان فراهم شده است. پروژه ژنوم شامپانزه (در حال انجام) و بررسی رابطه تكاملی آن با ژنوم انسان راه را برای درك هر چه بیشتر سازوكارهای عصبی و ذهنی انسان هموار كرده است. با تكمیل این پژوهش ها خودمان را بهتر خواهیم شناخت. هم اكنون پروژه های تكاملی گسترده ای در سرتاسر جهان در حال انجام هستند كه با ادامه این روند پزشكی، كشاورزی و دامداری و صنعت به ابزارهای فوق العاده كارآمدی مجهز خواهند شد. به همین سبب است كه قرن بیست و یكم را عصر بیوتكنولوژی یا فن آوری زیستی نامیده اند.  

مبلغان دینی به كلمه ی نمیدانیم علاقه خاصی داردند. آموزه ای در كلام آنهاست كه فضیلتی برای جهل قائل می شود. هر جا جهلی است، پایگاهی برای خود می یابند و هر گاه نوری بر جهلی تابید، تلاش میكنند دانش را به جهل مبدل كنند. "هنوز هیچ دانشمندی علتش را توضیح نداده، پس حق با ما است". یا "علتش آن نیست كه علم میگوید، پس حق با ماست." به قول ریچار داوكینز: " [دین پیشگان می گویند] اگر نمی دانید که چیزی چگونه کار می کند، نگران نباشید: رهایش کنید و بگویید کار خداست. نمی دانید ضربان عصبی چگونه کار می کند؟ بسیار خوب!  نمی دانید چگونه خاطرات در مغز ثبت می شوند؟ چه عالی! آیا پیچیدگی فرآیند فتوسنتز سرگیجه آور است؟ مرحبا! لطفاً دنبال حل این مسائل نروید. اصلاً ول شان کنید، و به درگاه خدا متوسل شوید. دانشمند عزیز، روی رازهایت کار نکن. رازهایت را برای ما بیاور، چون به دردمان می خورند. جهل ذی قیمت را با تحقیق خود هدر نده." 

اما این شوق دانستن است كه دانشمندان و خردمندان را پیش میبرد تا حقیقت بشناسند و دانش بشری را هرچه پربارتر سازند. جای تاسف است كه در این میان عده ای گوهر حقیقت را فرو می نهند و خیره سرانه زیر پوستین ژنده ی موهومات باستانی می خزند.

 بالای صفحه

 

منابع آنلاین برای اطلاع بیشتر

 

[1] Anthropocentrism

[2]  اشاره به قرآن ( سوره نحل آيه 15 ، لقمات آيه 10، انبيا آيه 31 و...) كه علت وجود داشتن كوه ها را جلوگيري از زلزله  ميداند !

[3]  عباس ميرزا از ژوبر(فرستاده ناپلئون) ميپرسد: دلايل پيشرفت شما و ضعف ما كدام است؟ آيا قابليت سكونت و باروري خاك و توانگري مشرق زمين از اروپاي شما كمتر است؟ شعاع هاي آفتاب كه پيش از شما بر ما مي تابد، آيا نسبت به شما نيكوكارتر است؟

[4]  اين جملات مربوط به پارگراف آخر كتاب داروين است، پاراگرافي كه در نقل قولها در آن تحريف شده است. براي مثال عبدالكريم سروش در كتاب "دانش و ارزش" پاراگراف آخر را اينگونه ترجمه ميكند:"اينگونه نگرش به حيات توسط خالق در يك يا چند موجود اوليه دميده شده است"  در حالي كه جمله اصلي چنين است: " There is grandeur in this view of life, with its several powers, having been originally breathed into a few forms or into one" پيدا كنيد خالق را!  ترجمه صحيح: در این نگرش شكوهمند به زندگي، حيات با نيروهاي چندگانه اش، در ابتدا در یک یا چند شکل پديدار گشته است.

[5]  در ميان دانشمندان و اديبان ايراني، خيام داراي جهان بيني علمي و مادي بود به همين دليل امروزه محبوب ترين شاعر در ميان دانشمندان و خردمندان جهان است. براي اطلاع بيشتر به مقدمه اي بر ديوان خيام نوشته صادق هدايت مراجعه كنيد.

[6]  در طی قرون وسطي دانشمندان اروپا براي گريز از محكمه تفتيش عقايد ميگفتند كه كار علم توضيح چگونگي طبيعت است نه علت آن، در قرن هاي بعد دانشمندان توانستند با آزادي بيشتر به چراها هم پاسخ دهند.

[7]    The origin of species, by means of Natural selection or the Preservation of Favored Races in Struggle for life    منشاء گونه ها بوسيله انتخاب طبيعي يا ابقاء نژادهاي مساعد در تلاش براي حيات  

[8]  كتاب "منشاء انواع"11 سال پس از انتشار، توسط ميرزا تقي خان انصاري كاشاني، طبيب و معلم مدرسه دارالفنون ترجمه و تحت عنوان "جانور نامه" در ايران به چاپ رسيد ولي امروز خبري از كتاب داروين در ايران نيست. هرچند نظريه تكامل در شكل امروزي اش مطرح است، اما جاي انقلابي ترين كتاب تاريخ علم در كتابخانه دانشگاه ها خاليست.

[9] Macroevolution

[10] Microevolution

[11]  البته قرار نيست كه هر كس همه نظريه هاي علمي را كاملاً درك كند، ولي در مورد تكامل اين رسم غلط جا افتاده كه هر كسي بنا بر برداشت سطحي يا اشتباه خود، تبديل به كارشناسي تمام عيار مي شود و انتقادهاي غير علمي خودش را به اسم علم جا ميزند. مرتضي مطهري در كتاب "علل گرايش به ماديگري" مينويسد: "ما خودمان وقتي آن نظريه (تكامل) را در كتابهاي مربوط به اين موضوع مطالعه ميكنيم در آنها نكات قابل توجه و تامل زيادي مي بينيم هر چند صد در صد قانع نشده ايم." سپس در انتقاد از تكامل مي گويد: "از نظر علم وراثت، انتقال صفات اكتسابي سخت مورد ترديد بلكه مورد انكار است" اگر ايشان نگاهي گذرا به يك كتاب يا حداقل يك مقاله مي انداختند ميديدند كه تكامل بر اساس ژنتيك يا به قول خودشان وراثت است نه صفات اكتسابي.

 [12] البته اگر بخواهيم سيستم ها را منظم بدانيم چرا كه نظم ايده اي ذهني است نه واقعيت خارجي- ن.ك بخش برهان نظم از كتاب نقد براهين وجود خدا

[13] اگرچه ممکن است برای توضیح تکامل نظم های پیچیده ای که از آغاز جهان با قوانین بنیادی فیزیکی اش شکل گرفته اند، فرض وجود خدا ضرورتی نداشته باشد، اما باز هم می توانیم وجود خدا را به عنوان منشاء ایجاد همه ی چیزها فرض بگیریم. این ایده، کار چندانی برای خدا باقی نمی گذارد: خدایا! "تنها کار بیگ بنگ را سروسامان بده و بعد برو استراحت کن و منتظر باش تا همه چیز خود به خود رخ دهد. شیمی-فیزیک دانی به نام پیتر اَتکینز در کتاب شیوایش به نام خلقت، خدای تنبلی را فرض می گیرد که می کوشد تا آنجا که می تواند کار کمتری برای شروع همه چیز انجام دهد. اتکینز توضیح می دهد که چگونه هر مرحله از تاریخ کیهان توسط قوانین ساده ی فیزیکی، از دوره ی قبلی اش ناشی شده است. آنگاه میزان کاری را که لازم بوده که خدای تنبل انجام دهد کسر می کند و عاقبت نتیجه می گیرد که این کار مورد نیاز درحقیقت صفر است!" (بخشي از نوشتار نامحتملی وجود خدا نوشته ريچارد داوكينز)

 

[14]  ميتوانيد ده ها بازي از اين دست را در ذهن انجام دهيد و ببينيد كه بعيد ترين احتمالات نيز  به صورت فزاينده، نه تنها ممكن بلكه عملي هستند. يك نمونه ديگر: يك سكه را روي زمين بيندازيد، نتيجه شير است. سكه دوم را بيندازيد، اين بار خط آمد. سكه را برداريد و آنقدر بيندازيد تا شير بيايد. حال به سراغ سكه سوم برويد و آنقدر بياندازيد تا شير بيايد. به همين ترتيب ميتوانيد بي نهايت سكه روي زمين داشته باشيد كه همه آنها به صورت تصادفي شير آمده اند.

 [15] بي توجهي و عدم آگاهي برخي از نويسندگان ديني سبب شده كه در نقد نظريه تكامل ابتدا شواهد و مدارك خيالي خود را براي "نظريه تخيلي تكامل" كه ساخته و پرداخته خودشان است ذكر كنند سپس ابطال آنرا نشان دهند. در "هزار و يك دليل"(سيد محمد شيرازي، ترجمه سيد جمال الدين دين پرور- انتشارات دارالفكر، قم-1347)  يكي از پر فروش ترين كتابها در نزد مسلمانان با چاپ هاي متعدد در چند كشور، مي خوانيم: از داروين سوال ميكنيم دليل بر سخنت چيست؟ داروين: دانش مرا وادار كرده اين سخن را بگويم. سوال: آيا ممكن است ما آن دانش را بدانيم. آن علمي كه تو را به سوي اين تئوري كشانده است؟ داروين: آن علم اين است كه ما ميبينيم انسان شبيه ميمون است (!)... [سر انجام داروين و فكرش سر افكنده و شكست خورده ميشوند] پس چرا سرگردانيد و از اين شاخه به آن شاخه مي پريد و خود را به سنگلاخ مي اندازيد؟ آري كسانيكه خدا و دين او را نميپذيرند به همين مشكلات مصائب برخورد خواهد كرد و سرانجام كه به بن بست رسيدند بيدار ميشوند. آنوقت مثلش مثل كسي است كه حاضر نشود چيزي را از راه صحيح بفهمد و بعد از زحمت فراوان بالاخره به ناچار به تسليم مي شود.هزار و يك دليل مينويسد: (سيد محمد شيرازي، ترجمه سيد جمال الدين دين پرور- انتشارات دارالفكر، قم): از داروين سوال ميكنيم دليل بر سخنت چيست؟ داروين: دانش مرا وادار كرده اين سخن را بگويم/ سوال: آيا ممكن است ما آن دانش را بدانيم. آن علمي كه تو را به سوي اين تئوري كشانده است؟ داروين: آن علم اين است كه ما ميبينيم انسان شبيه ميمون است (!) هزار و يك دليل مينويسد: (سيد محمد شيرازي، ترجمه سيد جمال الدين دين پرور- انتشارات دارالفكر، قم): از داروين سوال ميكنيم دليل بر سخنت چيست؟ داروين: دانش مرا وادار كرده اين سخن را بگويم/ سوال: آيا ممكن است ما آن دانش را بدانيم. آن علمي كه تو را به سوي اين تئوري كشانده است؟ داروين: آن علم اين است كه ما ميبينيم انسان شبيه ميمون است (!)

[16] در زمان داروين برخي افراد با استناد به ناكافي بودن عمر زمين تكامل را بي ثمر ميخواندند. مساله زمان يكي از درگيري هاي علم و دين بوده است. مسیحیان عمر جهان را چيزي در حدود 6000 هزار سال ميدانستند كه خدا آن را  ظرف هفت روز توسط آفريده شده است.(به گفته ی قرآن، الله زمین را در شش روزآفریده، البته با اندکی اشتباه محاسباتی!) با پيشرفت زمين شناسي بحث هاي گسترده اي در اين زمينه در گرفت اما در نهايت دينداران در يك عقب نشيني اعلام كردند روزهاي ذكر شده در تورات و قرآن به معني دوران هستند. (تاريخ علم و دين همواره شاهد اين عقب نشيني و توجيه ها بوده است، در مورد نظريه تكامل نيز پاپ ژان پل دوم و برخي علماي اسلام بعد گذشت صد و چند سالي از ارائه نظريه تكامل آنرا پذيرفته اند.)

[17] Homologous structures

[18]  طرفداران خلقت نيز توجيه جالبي براي اين همساني ها دارند: همانطور كه همه ساختمان هاي ساخته شده توسط يك مهندس تفاوت ظاهري و شباهت پايه اي دارند، موجودات نيز كه آفريده خدا هستند مشابه هم هستند. در اينجا بايد به دو نكته توجه كرد: يكي پندار اشتباه شباهت ساخته هاي بشر با اندامه هاي طبيعي. همه اجزاء ساخته هاي دست بشر مثل ساعت در جهت رسيدن به هدفي مشخص مثل تعیین زمان، عمل ميكنند در حالي كه تکامل اندامه ها نیازی به "مهندس" طبیعت ندارد و دومي اينكه هيچ مهندسي عمداً قسمتهاي ناقص، بي مصرف و حتي مخرب را در ساختمانش طراحي نميكند در حالي كه اگر جانداران (وكلاً جهان) خالقی داشته باشند، باید گفت که آن خالق به اندازه ی كم هوش ترين مهندس ها توانايي درك اين موضوع را نداشته است. در ادامه نوشتار توضيح مختصري در اين مورد داده خوهد شد.

[19] Imperfect Structures

[20]  Imperfect design -  مقايسه كنيد با يكي از جديد ترين اصطلاحات اختراع شده توسط طرفداران خلقت يعني "آفرينش هوشمندانه" يا Intelligent design

[21] Vestigial structures

[22] Homo neanderthalensis

[23] Homo sapiens

[24] اين فسيل در سال 1856 در نزديكي دوسلدورف آلمان پيدا شده بود. استخراج و تكثير ژنهاي mtDNA فسيل و مقايسه آن با بخش معادل در ژنوم انسان ساپينس نشان داد كه جد مشترك انسان امروزي و نئاندرتال ها حدود 600 هزار سال پيش زندگي ميكرده و نئاندرتال يك حد واسط تكاملي بين شانپانزه و انسان نيست بلكه يك بن بست (dead end) تكاملي بوده كه هم اكنون نسل آن منقرض شده است.

[25] Active site

Industrial melanism  [26]  نمونه هاي فراواني از تغيير رنگ صنعتي به ثبت رسيده است. در هر گوشه دنيا كه دستكاريهاي انسان رنگ محيط را تغيير ميدهد جاندارن نيز متحمل تغييرات رنگي ميشوند. 

[27] The Tiger Pufferfish (Fugu rubripes)

[28] Mus musculus

بالای صفحه

 

--------------------------------------------------------------

آثار دیگری از فرخ بیخدا

خانه | بالا